depths

There are 0 repository under depths topic.

• manydepth

  nianticlabs / manydepth

  [CVPR 2021] Self-supervised depth estimation from short sequences

  kitticityscapesdepthsmonodepthdepth-estimationpytorchcvpr2021cvprself-supervised-learningself-supervisedcost-volumesestimating-depths
  Language:Python 592

• MareenLoesing / GHF-Antarctica-Bayesian

  Bayesian inversion for thermal parameters and calculation of geothermal heat flow

  inversioncurieantarcticatemperaturesdepths
  Language:Python 8

• satyampatidar / Matrix-Patter-Fill-2

  Recursive function which goes through an empty matrix passed to it which has many levels of inner matrices with varying depths, all of them being empty.

  matrixinner-matricesdepthsfillstrvalpython
  Language:Python 1

• satyampatidar / Patter-Filling-Through-Recursion

  Recursive function which goes through a pre-filled matrix which has many levels of inner matrices with varying depths, that have been initialized with three alphabets each, in a sequence.

  recursionmatrixdepthspatter-fillingpython
  Language:Python 1