reconnaissance-framework

There are 2 repositories under reconnaissance-framework topic.

• 3klCon

  eslam3kl / 3klCon

  Automation Recon tool which works with Large & Medium scopes. It performs a lot of tasks and gets back all the results in separated files.

  reconautomationpenetration-testreconnaissance-framework3klcon
  Language:Shell 671
• chiasmodon

  chiasmod0n / chiasmodon

  Chiasmodon is an OSINT tool designed to assist in the process of gathering information about a target domain. Its primary functionality revolves around searching for domain-related data, including domain emails, domain credentials, CIDRs , ASNs , and subdomains, the tool also allows users to search Google Play application ID.

  asnattack-surfacebugbountybugbounty-toolcidrcredentialsemail-enumerationemailsinformation-gatheringintelligenceintelligence-analysisosintreconnaissancereconnaissance-frameworksubdomain-enumerationsubdomainschiasmodon
  Language:Python 402
• IsmailScript

  thearrival / IsmailScript

  Is a tool written by using python programming language. Enable a penetration testers to save a time and performing a full Reconnaissance and Information Gathering on any Web Application Server.

  python3cybersecuritydns-serverdnsismailscriptnmapwhoisserverbannerportscannerserverscanwebapplicationreconnaissancereconnaissance-frameworksocketbs4requestspythonipinformation-gatheringpenetration-testers
  Language:Python 41

• krishpranav / vuln-scanner-flask

  A flask web app made for scanning vulnerabilites on a website, network exploitation, reconnaissance

  flaskpython3pythonvulnerabilityvulnerability-scannersvulnerability-scannernetworknetwork-exploitationreconnaissancereconnaissance-framework
  Language:Python 19

• chiasmod0n / chiasmodon-mobile

  Chiasmodon Mobile - OSINT Tool for Domain Information Gathering on Android.

  apkapktoolasnattack-surfacebugbountybugbounty-toolchiasmodoncidrcredentialsemail-enumerationemailsinformation-gatheringintelligenceintelligence-analysisosintreconnaissancereconnaissance-framework
  Language:Dart 10

• digital-clouds / osint

  Open Source Intelligence - Reconnaissance Framework

  open-source-intelligenceyamlosintreconnaissance-framework
  Language:JavaScript 8

• shrkwv / ricco

  Simple Reconnaissance framework.

  reconnaissance-frameworkreconinformation-gatheringvector
  Language:Python 4

• emenmousavi / DMARCShield

  DMARCShield is a Python program for email authentication and security. It offers a DMARC checker to ensure domain security, and a spoofing email sender to test for vulnerabilities. Protect your email communication and keep your domain safe with MailSecure.

  dmarcdmarc-analyzerdmarc-recorddomainemailreconnaissancereconnaissance-framework
  Language:Python 3

• markgacoka / r3c0n

  A tool for performing reconnaissance on web targets in Python

  cybersecurityreconnaissancereconnaissance-frameworkbugbountyreconpythonlibrary
  Language:Python 2
• LaMaquina

  Archive-Puma / LaMaquina

  💽 Recognition done the way that matters

  maquinareconreconnaissance-frameworkrecon-enginescanner
  Language:Rust 1

• nishanthakur / ReconMaster

  ReconMaster is an automated reconnaissance web application that performs active reconnaissance on the provided domain and displays the results in user friendly manner.

  reconnaissance-frameworkdjangodjango-rest-frameworkdatatables-plugincelery-redis
  Language:HTML 1

• r9in / bugbounty-helper

  discordhackingpentestingreconwebhackingreconnaissancereconnaissance-frameworkbug-bountybugbounty
  Language:Python 1

• emenmousavi / LightDNS-Checker

  LightDNS Checker is a Python script for checking a domain's DNS records and their DNS zone provider using dnspython library. Ideal for system administrators, network engineers, and security analysts.

  dnsdns-recorddns-serverdomainreconnaissancereconnaissance-framework
  Language:Python 0

• Vanessapan001 / Reconnaissance

  planningreconnaissancereconnaissance-frameworkpenetration-testing
  0