domaindrivendesign

There are 0 repository under domaindrivendesign topic.

• bwaidelich / dcb-eventstore

  Implementation of the Dynamic Consistency Boundary pattern described by Sara Pellegrini

  dcbddddomaindrivendesigndynamicconsistencyboundaryeventsourcing
  Language:PHP 9

• bwaidelich / dcb-example-courses

  Simple example for the Dynamic Consistency Boundary pattern described by Sara Pellegrini

  dcbddddomaindrivendesigndynamicconsistencyboundaryeventsourcing
  Language:PHP 8

• standard-api / core

  Stapi Core is set of packages for intuitive, declarative, Domain-Driven Design (DDD) business logic modeling in the age of AI.

  cqrsdomain-driven-designdomaindrivendesignevent-modelingeventmodelingsymbolic-systemsgraphgraph-algorithmsgraph-theory
  Language:Java 6

• addiks / symfony_rdm

  Helps with the use of domain driven design & rich domain model in symfony / doctrine applications.

  ormsymfonyphpdoctrine2domaindrivendesign
  Language:PHP 5

• Hasanaltan-cpu / Social_Media_Project

  In this repository,my main goal is to demonstrate my asp.netcore skills on Domain Driven Design Architecture.For this , i use this architecture for build up my application as image in the ReadMe.U can reach in this repository also ExternalLogin for GoogleAuthentication.I provide two factor authentication to application members.Moreover,members who is signed in the application can chat in messenger.In this part of the Social_Media_project i used SignalR for real time communication.In addition to that members can schedule their calendar programme as birthday,sleeping time,lunch etc.By using this application members can post the others.The others can like and mention(comment) to post.All members be able to follow each other.As i mentioned before,users can find them by using Search tab.(Email,Name,UserName).I use UnitOfWork for all transactions.I use Async Programming & Code First.I try to write all codes in the light of Solid Principle & OOP rules.

  asp-net-coreasp-net-core-mvcidentity-managementunitofworksignalr-coregoogleauthenticaionfluentvalidationdomaindrivendesignddd-architectureautomappersocialmediaoop-principlessolid-principlesautofac-containerdependency-injection
  Language:JavaScript 5

• mehrpooyanavaie / ProductManagement

  Advanced Product Management API built with ASP.NET Core 8, leveraging Clean Architecture, CQRS with MediatR, RabbitMQ, and Redis to deliver optimal performance and high scalability for efficient product workflows.

  cleanarchitecturedomaindrivendesigndotnetjwtrabbitmqratelimitredisrepositorypatternrestapisqlserverunitofworkpatterncqrsmediatrdesignpatternsefcoremanualgarbagecollectionoptimization
  Language:C# 5

• sabey / ddd

  Golang Domain Driven Design

  dddddd-exampledomain-driven-designdomaindrivendesigngogolangjwt
  Language:Go 2

• dsolemorera / curso-fundamentos-eventstorming

  Curso de Fundamentos de EventStorming 🟧🟦

  domain-driven-designdomain-drivendesigndomaindrivendesignevent-stormingeventstorming
  1

• dsolemorera / eventstorming-fundamentals-course

  EventStorming Fundamentals Course 🟧🟦

  domain-driven-designdomaindrivendesignevent-stormingeventstormingdomain-drivendesign
  1

• HallowKnight / Students-Sample

  Simple DDD and CQRS With MediatR + Small Examples of SignalR And RabbitMQ(MassTrasit)

  domaindrivendesignsignalrmediatrrabbitmqmasstransitcqrsddd
  Language:JavaScript 1

• HamedStack / HamedStack.AggregateRoot

  A library facilitating aggregate root functionalities, optimizing Domain-Driven Design (DDD) by ensuring integrity and consistency across domain boundaries in complex systems.

  aggregate-rootcsharpdomain-driven-designdomaindrivendesigndomaineventsdotnetdotnet-coredotnetcoreentityintegration-eventsutilityvalue-object
  Language:C# 1

• Miczeq22 / ddd-node

  Example of DDD project written in Node.js

  dddnodeclean-architectureclean-codenodejsddd-architecturedomaindrivendesignevent-storming
  Language:TypeScript 1

• CodeHariK / Go-Experiments

  Cloud programming with Go language

  distributed-systemsdomaindrivendesigngofibergolanggolangexamplesgrpcgrpc-go
  Language:Go 0

• duymon178 / angular-giphy

  Simple website that display GIFs from Giphy. Built using Angular, powered by Nx Monorepo. Libraries' structure follows domain driven design with linting rules set up.

  angularmonorepodomaindrivendesignmarble-testingnxjest
  Language:TypeScript 0

• jokk-itu / simple-shop

  Project creating the simple shop from the database-modelling website.

  csharpdomaindrivendesigndotnetentityframeworkcore
  Language:C# 0

• antgerasim / DeedCurrencyPay

  DDD и TDD пример ядра трансакции банка по основным операциям (пополнение, снятие, конвертация валют, выписка по банковскому счету).

  banking-apidomaindrivendesigntestdrivendevelopmenttransaction-system
  Language:C#