fix blast output "InvalidFASTA", reviewer 2
molsim opened this issue · comments
Alexey Shaytan commented
- When the database is challenged with a non histone example (see fasta bellow), it retrieves a "invalid fasta" legend. This fasta is not an invalid one, instead, a legend indicating that no hit were found in the db should appear.
non histone example:
tr|A0A0E8A606|A0A0E8A606_STREE Histone acetyltransferase Gcn5 OS=Streptococcus pneumoniae GN=Histone acetyltransferase Gcn5 PE=4 SV=1
MSNYRRTSKPKTEHIKKGFTVFQKTITTIGSILGLITAGITIMNALDNNNKNTKKEPTTS
QTTTFVKEIQKESPQENTTPNKENNTSQEKTQQEETPKSSVKEEKKEDQKTATQDSTTPA
TSKPATENEKQPNTPTSENNTQ
Alexey Shaytan commented
Fixed by 77dcb9c