gravimetric

There are 0 repository under gravimetric topic.

• tobiasbrestrich / NFFT-based-Hilbert-transform

  Computes the Hilbert transform of vector fields in the space domain. The convolution sum is efficiently calculated by a fast summation algorithm.

  geophysicsnffthilbert-transformgeomagneticgravimetric
  Language:MATLAB 6

• epccs / Gravimetric

  ATmega324pb controller board for gravimetric method flow meter and prover calibration

  avrrpuadptrpupigravimetriccontrol-boardinput-captureopen-source-hardware
  Language:C 1

• lucamir / iGravToCSV

  This script loads the .tsf file generated from the GWR superconducting relative gravimeter iGrav and converts them to the CSV format. The generated CSVs will also be cleaned up of write errors present in the original files such as NaN-only rows or time jumps due to GPS connection

  csvcsv-exportfile-formatfile-formatsgravimetergravimetricgravimetrygravitygwrigravtsf
  Language:Python 1