email-service

There are 1 repository under email-service topic.

• SanjaySunil / email-scraper

  Generate thousands of temporary emails within seconds!

  emailscraperemail-scraperpythonemail-generatorscrapetemp-emailtemporaryautomationemail-scrappingemail-serviceweb-scraperweb-scraping
  Language:Python 51

• mariusangelmann / Wiedervorlage

  Email-based reminder service - schedule reminders by sending emails to time-coded addresses like remind+1h@domain.com

  automationemailemail-serveremail-servicenodejsnotificationsproductivityreminderremindersschedulerself-hostedsmtptime-managementtimemanagementtypescript
  Language:TypeScript 34
• 3mail

  mohamedmansour / 3mail

  Implementing a decentralized email on the blockchain using Secure IPFS as message channels and ENS as the DID address resolutions!

  ethereumceramicorbitdbensipfsemail-service
  Language:TypeScript 27

• jessecookedesign / rpl

  Reference for Responsys Personalization Language (RPL)

  developmentemailemail-developmentemail-marketingemail-servicefreemarkerhtmloracleoracle-responsysresponsysresponsys-personalization-languagerpl
  13

• cossssmin / esp-list

  A list of Email Service Providers

  email-platformemail-providersemail-senderemail-serviceesp
  Language:JavaScript 8

• JailsonJr-BR / skymail

  A robust TypeScript email service package with automatic failover and multiple provider support. Built for reliability and ease of use in modern Node.js applications.

  emailemail-senderemail-servicemailgunsendgridtypescript-library
  Language:TypeScript 6

• Jayanth-MKV / send-any-email

  Rest API For Email Service - Send Bulk Emails For Free & Host , Integrate with your application

  emailemail-apiemail-applicationemail-hostingemail-integrationemail-serveremail-servicerestapisend-emailsendmailbulk-ema
  Language:Handlebars 4

• TeoSean00 / GoBook-Backend

  A one-stop class booking application built with a Microservices Architecture to manage a company’s class and user system, storing & displaying information for the classes and users via a catalogue page, along with a class reviewing functionality and a class recommendation feature for users based on their previously attended classes.

  email-serviceflaskjavascriptkafkakong-api-gatewaymicroservices-architecturepythonreacttailwindcssclass-booking-applicationexpressjsnodejsspringbootdockermongodbstriperabbitmq-message-brokerwebsocketgoogle-oauth-login
  Language:Python 4

• TeoSean00 / Vendor_Form_Management_System_Backend

  A one-stop Vendor & Form Management System that provides CRUD features for vendors, forms & for the interactions between them, with other features such as a form page design & creation from scratch, an automated email reminder service, coupled with curated dashboards that highlight key, calculated business insights throughout the business process.

  bootstrapchartjscssdashboardsdockeremail-serviceform-managementjavajavascriptjwt-authenticationmavenmongodbmvc-architecturepdf-generationspringbootvendor-managementvuejsword-generationemailjs
  Language:Java 4

• TeoSean00 / Vendor_Form_Management_System_Frontend

  A one-stop Vendor & Form Management System that provides CRUD features for vendors, forms & for the interactions between them, with other features such as a form page design & creation from scratch, an automated email reminder service, coupled with curated dashboards that highlight key, calculated business insights throughout the business process.

  bootstrapchartjsdashboardsdockerform-managementjavajavascriptmavenmvc-architecturespringbootvendor-managementvuejscssemail-servicejwt-authenticationmongodbpdf-generationword-generationemailjs
  Language:Vue 4

• Hajar013 / Walletify

  An e-wallet application built with .NET 8 MVC for user management and expense tracking. It offers a user-friendly interface, efficient transaction handling, and external service integration. Developed as the final project for Gaza Sky Geeks' Market Ready Developer training.

  asp-net-coreasp-net-mvcbackground-jobsemail-servicejob-schedulingmvc
  Language:JavaScript 3

• hemantDwivedi / password-generator-tool

  Create and customize strong passwords effortlessly with the Password Generator Tool. Tailor your passwords, send them securely via email, and verify their strength—all in one place.

  email-servicejava-projectpassword-generatorreactjsspring-bootstrong-password-generatorfull-stack-projectjava-password-generatorjavaprojectjava-dockerjavascriptpassword-strength-checkpassword-verification
  Language:JavaScript 3
• DMail_SpamBox

  seanpm2001 / DMail_SpamBox

  🥡️📧️📦️ The DMail implementation of an Email Spam box.

  cssdmaildmail-spamboxdsuiteemailemail-servicegpl3gplv3mdspam-emailsspam-filteringspam-foldertxtspambox
  Language:CSS 3

• yorsh130204 / SpeedyMail

  SpeedyMail: Email service. Send and manage emails effortlessly. Features: contact form for sender/recipient names and message body.

  email-managementemail-serviceinformation-technologyinterface-designweb-developmentmultiplatform-development
  Language:CSS 3

• Perfigent-Org / MailService

  This is Email Service like Gmail, Outlook App. We are using MailBee.Net for Email Communication and for Connectivity we are using 0Auth2.0, Imap, SMTP

  email-serviceemail-communicationoauth2imapsmtp
  Language:C# 2

• SatyamOzaR / Google-App-scripting

  Create Web-app to update data in google sheets, and sending 'gmail alerts' based on input data conditions; using python script

  app-scriptinggoogle-sheetspython-scriptemail-service
  Language:Python 2

• TeoSean00 / GoBook-Frontend

  A one-stop class booking application built with a Microservices Architecture to manage a company’s class and user system, storing & displaying information for the classes and users via a catalogue page, along with a class reviewing functionality and a class recommendation feature for users based on their previously attended classes.

  class-booking-applicationdockeremail-serviceexpressjsflaskgoogle-oauth-loginjavascriptkafkakong-api-gatewaymicroservices-architecturemongodbnodejspythonrabbitmq-message-brokerreactspringbootstripetailwindcsswebsocket
  Language:JavaScript 2

• tsarchghs / Flastell

  Flastell is an open-source messaging service.

  pythonflasksqlite3email-service
  Language:Python 2

• websifyGR / RESThook

  Router handler for Webhooks pool, Uniform RESTful API CRUD Operations and any other need that produce, request, analyze and transport data for any scope of use, by using any available processing source

  big-data-analyticsbigdatacrud-operationemail-servicefiles-managementfiles-servicerest-apirestful-apisms-gatewaysms-servicewebhooks
  Language:PHP 2

• 2020-HelloWorld / ChainForge

  Blockchain based project to provide a platform for artists

  blockchaincontractsdigital-artemail-serviceganachemarketplacepythonsolidity
  Language:HTML 1

• byteskeptical / liam

  mail without fail

  awsaws-sesemailemail-securityemail-senderemail-serviceencryptedsessmtp
  Language:Ruby 1

• crossphoton / email-microservice

  gRPC based emailing microservice

  microservicegrpcgolangemail-service
  Language:Go 1

• immortalWebDev / Client-Mail-Box

  Mail Express is a robust web app built with React, Redux, and Firebase. It offers efficient email management with features like composing, inbox management, sent items, deleting, starring emails, and real-time conversations. The app provides a responsive UI, secure authentication, email sanitization with DOMPurify, and online-offline notifications.

  dompurifyemail-servicefirebase-authfirebase-realtime-databasereactredux
  Language:JavaScript 1

• MartinLupa / go-email-service

  A Go-based email service with support for multiple providers like Mailgun and SparkPost. Exposes a RESTful API for sending emails via HTTP POST requests. Includes Docker support for deployment and environment-based configuration for flexibility. Ideal for integrating reliable email-sending functionality into applications.

  docker-composeemail-servicegolangmailgunrest-apisparkpost
  Language:Go 1

• maxstralin / mailjet-simple-client

  A simple, yet customisable, .NET standard client for interacting with Mailjet

  csharpmailjetmailjet-apiapi-clientapiapi-wrapperdotnetdotnet-standarddotnet-coreemailemail-senderemail-servicewrappersdkmailjet-sdk
  Language:C# 1

• No-Country-simulation / s18-05-m-csharp-react

  AdopPet es una aplicación web diseñada para facilitar la adopción de animales y ayudar a conectar personas que han perdido o encontrado mascotas.

  pet-adoptionasp-netemail-serviceasp-net-web-apiadoptable-animalsanimal-rescue
  Language:TypeScript 1

• sedadiriker / MeetManagerSystem

  asp-net-mvcemail-servicejwt-authenticationmssqlnetcore8passwordhashingswagger
  Language:CSS 1

• SimoneSichili / htmlcss-gmail

  Email service replica

  cssemail-serviceemail-templategmailhtml
  Language:HTML 1

• TharindaNimnajith / SLIIT_Y3S1_DS_SensorApp

  Fire Sensor Alarm Appllication includes React.js web client, Java Swing desktop application with bi-directional Java GUI designer called Windows Builder, REST API with Express.js, Node.js and Mongoose with email & SMS services, MongoDB as the NoSQL database, Java RMI Server and sensor simulators built with JQuery, JavaScript & AJAX.

  ajaxdesktop-applicationemail-serviceexpressjsjavajava-swingjavascriptjqueryjsonmongodbmongoosenodejsreactjsrest-apirestful-webservicesrmi-clientrmi-registryrmi-serversms-serviceweb-application
  Language:Java 1

• zainali954 / Email-Service-API

  A lightweight and customizable email-sending microservice built with Node.js and Nodemailer. Designed for seamless integration into applications requiring email verification or general email functionality.

  email-servicenodejsnodemailer
  Language:JavaScript 1

• PCgithub-ux / my-portfolio

  My Portfolio

  apexemail-serviceexperience-cloudlwcstatic-resources
  Language:HTML 0

• ransuum / SeeYaaFx

  diploma project(unfinished)

  email-servicejavafxmapstructpostgresqlrestful-apispring-bootaivertex-ai
  Language:Java 0

• Shivansh-Khunger / mailchannels-cloudflare-worker-example

  mailchannels-cloudflare-worker-example: A reference implementation of a MailChannels Cloudflare Worker, demonstrating email sending and handling capabilities with a serverless, edge-computing approach.

  cloudflarecloudflare-workercloudflare-workersemail-senderemail-serviceemail-workermailchannelsworker
  Language:TypeScript 0

• MrEshboboyev / background-jobs-with-hangfire

  A .NET application for managing email services using Hangfire background jobs. Built with PostgreSQL for data persistence, SMTP for email delivery, and the Options pattern for configuration flexibility.

  asp-net-corebackground-jobsdotnet-coreemail-servicehangfirejob-schedulingoptions-patternpostgresqlsmtp
  Language:C#

• Murs000 / WeatherReportApi

  WeatherReportApi is a weather reporting system that fetches weather data from OpenWeatherMap, schedules reports via Quartz.NET, and sends them to subscribers via email. It uses PostgreSQL for data storage, follows a structured architecture, and includes features like job scheduling, API versioning, and detailed statistics.

  automappercsharpdockerdocker-composedotnet8email-serviceopenweathermappostgresqlquartznetswaggerwebapi
  Language:C#

• tennyros / email-service

  Spring boot Email service with Kafka

  email-servicekafkaspring-boot-application
  Language:Java