dissipation

There are 0 repository under dissipation topic.

• fatihbahri / Creating-SWAN-Models

  This repostory contains notebook files that provide the necessary adjustments to the data from the DUCK94 project to create and evaluate SWAN models. This notebooks have prepared for an international research project which supported by TUBITAK

  dissipationnumerical-analysisnumerical-methodsswantriadwavecoastalcoastal-engineeringoceanography
  Language:Jupyter Notebook 6

• akilm / Logic-Gates-Sizing-Automation

  Determining the sizing of transistors using heuristic algorithms and logical effort to obtain optimal delay and power

  heuristic-algorithmsmos-transistorstransistorsdelaydissipation
  Language:MATLAB 3

• chinghao0703 / ThermoTransport

  thermodynamicskinetic-modelingentropy-productiondissipationfutile-cycleprotein-protein-interactionmatlab
  Language:MATLAB 1

• mech-zhang / dissipation_of_linkages.github.io

  Dynamics equation of linkage with dissipation function

  dissipationmatlab
  Language:MATLAB 0

• OrbitalCalculations / AstroSolution

  A TokamakUI and SwiftWasm based WebApp to calculate orbital solutions with a tidal dissipation and dynamical ellipticity Earth model based on Laskar et al. (1993), providing solutions for La1993; La2010a,b,c,d; ZB2017e; and ZB2018a.

  astronomymilankovitchtidaldissipationdynamicalellipticityswiftwasmtokamakuiwebapp
  Language:Swift 0

• jfriedlein / energy-based_arc-length_method-dealii_public

  Implementation of a dissipation energy-based arc-length method in the C++ library deal.ii for coupled elastoplastic-damage materials (the theory and code might be published in the future)

  dealiiarc-lengthdissipationenergy-basedelastoplastic-damage