data-search

There are 1 repository under data-search topic.

• alephdata / aleph

  Search and browse documents and data; find the people and companies you look for.

  data-searchgraph-databaseinvestigative-journalismjournalismosintpython
  Language:JavaScript 1959

• vrikodar / Trishul

  Trishul searches for sensitive data with options to specify custom files and custom keywords to look for in the filesystem

  sensitive-data-securitypassword-finderapi-keysdata-searchforensics-tools
  Language:Python 9

• Ian-Carneiro / OGD_Search_Engine

  OGD Search Engine

  ogdopenindexing-enginedata-searchsearch-enginedadosbuscadorpythonsolr-searchpostgresqlneo4jindexationindexingindexsearch-interfacesolr
  Language:Python 7
• data-search

  rgiovani / data-search

  🔍 This is an intelligent JavaScript search project, developed to solve the search needs in the MyWay application, which was developed at the "Escola de TI" in graduation time, enjoy.....: Systems Analysis and Development. 🎓🎓🎓

  graduation-projectknowledgedata-searchsmart-searchmyway
  Language:JavaScript 6

• X5GON / platform-api

  Cross modal, cross cultural, cross lingual, cross domain, and cross site global OER network

  open-educational-resourcesdata-processingdata-searchrecommender-engine
  Language:JavaScript 5

• p-j-r / data-search-sys

  A Data Search System inspired by Google's Page-Rank algorithm. Coded in C++.

  data-searchpagerankpage-rankcppgoogle
  Language:C++ 2

• rgiovani / myway-backend

  🎓🎓 Projeto desenvolvido na escola de TI para a conclusão do curso de Análise e Desenvolvimento de Sistemas - Unicesumar, 2020.

  escoladetimywaymysqldata-searchastahtypescriptjavascript
  Language:TypeScript 2

• NASA-PDS / registry-api

  Web API service for the PDS Registry, providing the implementation of the PDS Search API (https://github.com/nasa-pds/pds-api) for the PDS Registry.

  data-searchjavanasanasa-apipdspds4
  Language:Java 1

• w2xim3 / sqljson

  A powerful tool that allows users to query JSON data using SQL-like syntax. Effortlessly search, filter, and manipulate your JSON data with familiar SQL queries.

  bugbountydata-filteringdata-manipulationdata-searchjsonsqlsql-like-syntax
  Language:Python 1

• CasperJaa / Market-research-for-an-agri-food-company

  Market research to determine which countries are the most interesting to explore as this agri-food company takes its first steps onto the international market.

  data-analysisdata-analysis-pythondata-sciencedata-searchhierarchical-clusteringkmeans-clusteringmachine-learning-algorithmsmarket-datamarket-researchpca-analysis
  Language:Jupyter Notebook 0

• jorgekorgut / playground-custom-quadtree

  This project serves as a playground for developing an optimized modified quadtree aimed at minimizing cache misses and enhancing specific data search capabilities.

  data-searchoptimizationquadtree
  Language:C++ 0

• wbsg-uni-mannheim / MannheimSearchJoinsEngine

  A Search Join is a join operation which extends a user-provided table with additional attributes based on a large corpus of heterogeneous data originating from the Web or corporate intranets.

  data-integrationdata-lakesdata-searchtable-augmentation
  Language:Java 0

• R00tendo / goramq

  A fast Golang program to load files into memory and search through then via an API

  backend-apidata-searchdatabase-searchfile-searchgolangrest-api
  Language:Go