jowch / ProteinEmbeddings.jl

An unofficial Julia interface for FAIR-ESM embeddings!

Home Page:https://github.com/facebookresearch/esm

Geek Repo:Geek Repo

Github PK Tool:Github PK Tool

Protein Embeddings with FAIR-ESM

This package provides a Julia interface for FAIR-ESM, first published in Rives et al., PNAS, 2021 as ESM-1 and Lin et al., Science, 2022 as ESM-2. The sequence representations produced by these models (as backbones) can be used as starting points for downstream analyses.

Installation

At the moment, this package is not yet registered in Julia's General registry, though this is planned for the future. For now, the way to use this package is through a clone of the repository. Alternatively, you may use a Local Registry. If you or your org already maintains a LocalRegistry, you may register this package to that repository.

First, clone this repository. Then in Julia's Pkg mode, first run instantiate followed by build to set the package up. This will also install a copy of miniconda via Conda.jl along with some Python dependencies including pytorch and fair-esm.

Usage

Generating Embeddings

The following is an example of how one can generate embeddings:

using ProteinEmbeddings

target = "[LL-37, 37 aa]"

model = ProteinEmbedder(ESM2_T36_3B_UR50D)
# or, equivalently,
# model = ProteinEmbedder{ESM2_T36_3B_UR50D}()

embedding = embed(model, target) # => 2560 dim Vector

Here, we instantiate an ESM2_T36_3B_UR50D model (see FAIR-ESM for more information about the available models). Then, we use the embed method to compute the model representation for our target amino acid sequence.

The model to be used is specified by a type of the same name written with all capital letters (e.g., ESM2_T36_3B_UR50D).

In addition to single sequences, we can also produce embeddings for a Vector of sequences.

targets = [
    "[LL-37, 37 aa]",
    "[LL-37, 37 aa]",
    "[LL-37, 37 aa]",
    "[LL-37, 37 aa]",
]

embeddings = embed(model, targets)  # => 2560 x 4 Matrix

BioSequences

One can also produce embeddings for AminoAcid sequences from BioSequences.jl by loading the BioSequences package alongside ProteinEmbeddings.

using BioSequences
using ProteinEmbeddings

target = aa"[LL-37, 37 aa]"

model = ProteinEmbedder(ESM2_T36_3B_UR50D)
# or, equivalently,
# model = ProteinEmbedder{ESM2_T36_3B_UR50D}()

embedding = embed(model, target) # => 2560 dim Vector

Available Models

The list of available models can be found at the top of the src/model.jl file.

abstract type ESM1B_T33_650M_UR50S <: Model end
const ESM1 = ESM1B_T33_650M_UR50S

abstract type ESM2_T33_650M_UR50D <: Model end
abstract type ESM2_T36_3B_UR50D <: Model end
abstract type ESM2_T48_15B_UR50D <: Model end
const ESM2 = ESM2_T33_650M_UR50D

One can get the "name" of the model as appears in the FAIR-ESM repository using the modelname method. The size of each model's representations can be found using the modeldims method.

modelname(ESM2_T36_3B_UR50D)
# => "esm2_t36_3B_UR50D"

modeldims(ESM2_T36_3B_UR50D)
# => 2048

About

An unofficial Julia interface for FAIR-ESM embeddings!

https://github.com/facebookresearch/esm


Languages

Language:Julia 100.0%