Utility module to asynchronously query the EBI Tools REST API
Only BLASTp and Needle endpoints are implemented, but the codebase may be useful to add other endpoints easily.
pip install git+https://github.com/OxfordNuffieldWRH/ebi-tools-api
from ebi_tools_api import EBITools
ebi = EBITools(email='your@email.com')
mouse_taxonomy_id = 10090
human_il6 = 'MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM'
result = await ebi.blastp(
sequence=human_il6,
title='Search for human IL6 homologues in mouse',
taxids=mouse_taxonomy_id
)
# return a DataFrame
result.hits
Simplified summary:
result.hits_simple
Underlying JSON data converted to Python dict:
result.data
Nice graphical summary for Jupyter notebooks:
result.summarize()
By default the results will be cached on disk in .ebi_tools_cache
to minimise traffic to EBI tools.
To clear cache, either:
- pass
reset_cache=True
to a query function (e.g.blastp(sequence=human_il6, reset_cache=True)
preserving all other arguments as in original call - remove the contents of this hidden directory to clear entire cache at once
Pass verbose=True
to see cache status.
You can change the path to cache in EBITools
constructor:
ebi = EBITools(email=my_email, cache_dir='some/path/to/cache/dir')
After sending an initial query, the tool will check for the result every i
seconds, where i
increases by one after each failed attempt,
up to a configurable maximum interval (default 5 seconds). By default 100 attempts will be made. This can be customised in the constructor:
ebi = EBITools(email=my_email, attempts_threshold=20, backoff_limit=10)