Output proteome file has unexpected sequences
alexvasilikop opened this issue · comments
Hello,
I want to extract the translated cds features (concatenated per gene) from the gff but some extracted sequences have a "." character in the sequence.
Is this expected?
e.g. see below:
$ /mnt/sda1/Alex/software/gffread-0.12.7.Linux_x86_64/gffread -C -g Schmidtea_mediterranea.assembly.fa -y Schmidtea_mediterranea.pep.fa --no-pseudo Schmidtea_mediterranea.no_iso.gff
One sequence in the fasta looks like this:
SMEST011213001.1
MASLKDERSSAEHIRV.LETEAGEYDKLNEKLTDKGNNVKSPEPEISIQLKTSTTKEMKKKLREKINQEL
PSKNSDETEIYSRKSTMYEITRDEPEMRKQEPIYSSLKRNIQEMHSERKCNEEDLNEKKRNWKFGKENS
You can see there is a dot there in the first line.
Best and thanks for the help
Hello,
I have encountered the same confusion. Is this problem a comment problem or something? This "." should be deleted or replaced with another character.
Best and thanks for the help
That period character represents a stop codon encountered in the translation. I know the "standard" is unfortunately to use the star ( *
) character instead, which seems rather inappropriate and misleading for my regex-biased mind :). Period means "end of sentence" so it seemed natural to use that character to depict the stop codon "translation".
Anyway, gffread has a -S
option to force the translated output use *
instead of .
for stop codons, if you prefer that.